PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g040096m
Common NameCISIN_1g040096mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24943.3 Da    PI: 8.6355
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g040096mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF892.5e-28959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien snrqvt+skRrngilKKA+E+ vLCda+v++ii++s+gk+++y+s
  orange1.1g040096m  9 KRIENASNRQVTYSKRRNGILKKAKEITVLCDAKVSLIIYASSGKMHDYCS 59
                       79***********************************************96 PP

2K-box78.91.2e-2671167197
              K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                        y+++sg++l++ k+e+l++e++++k+e++ +q ++Rhl Ged++sL+ keL  Le++Le++l +iR+k++e + ++ ++ +++e+e++  + 
  orange1.1g040096m  71 YHRQSGRRLWDPKHENLSNEIERIKRENDRMQIKLRHLNGEDISSLNPKELIALEDALENGLVSIRDKQSEKMETMRKNGKMMEEEHNYLKF 162
                        78899999****************************************************************99999999999999999999 PP

              K-box  93 aLrkk 97 
                         Lr++
  orange1.1g040096m 163 VLRQQ 167
                        99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.847161IPR002100Transcription factor, MADS-box
CDDcd002659.56E-39280No hitNo description
SuperFamilySSF554551.96E-34295IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.7E-1883162IPR002487Transcription factor, K-box
PROSITE profilePS5129714.0584170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGRGKIEIKR IENASNRQVT YSKRRNGILK KAKEITVLCD AKVSLIIYAS SGKMHDYCSP  60
STSLVDILEQ YHRQSGRRLW DPKHENLSNE IERIKRENDR MQIKLRHLNG EDISSLNPKE  120
LIALEDALEN GLVSIRDKQS EKMETMRKNG KMMEEEHNYL KFVLRQQEIA RQQQELAMEN  180
SVSAEIDNYQ RENHHDYAYH VQPIQPNLQE RI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-16196190Myocyte-specific enhancer factor 2B
1tqe_Q8e-16196190Myocyte-specific enhancer factor 2B
1tqe_R8e-16196190Myocyte-specific enhancer factor 2B
1tqe_S8e-16196190Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015384126.11e-155PREDICTED: floral homeotic protein FBP1-like
SwissprotQ034882e-94FBP1_PETHY; Floral homeotic protein FBP1
TrEMBLA0A067GLG01e-156A0A067GLG0_CITSI; Uncharacterized protein
STRINGPOPTR_0005s20480.11e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.15e-87MIKC_MADS family protein